PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast06G088900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 433aa    MW: 46102.5 Da    PI: 8.9734
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast06G088900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.85.1e-54361641128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+
  Brast06G088900.1.p  36 LPPGFRFHPTDEELVVHYLKKKAAKAPLPV-TIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKP 125
                         79****************************.89***************988899************************************* PP

                 NAM  92 vlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++++   +e+vg+kk Lvfy+g+ pkg kt+W+mheyrl
  Brast06G088900.1.p 126 IMASgcAREKVGVKKALVFYRGKPPKGLKTNWIMHEYRL 164
                         ***9888899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-6327204IPR003441NAC domain
PROSITE profilePS5100561.43936204IPR003441NAC domain
PfamPF023656.7E-2837164IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009753Biological Processresponse to jasmonic acid
GO:0045995Biological Processregulation of embryonic development
GO:0048317Biological Processseed morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MRSMGSPDSS SGSAPPQHQH QHHQQQQRAG NSAPELPPGF RFHPTDEELV VHYLKKKAAK  60
APLPVTIIAE VDLYKFDPWE LPEKATFGEQ EWYFFSPRDR KYPNGARPNR AATSGYWKAT  120
GTDKPIMASG CAREKVGVKK ALVFYRGKPP KGLKTNWIMH EYRLADSSSS ATTSRPPPVV  180
AGGSGGRAAS LRLDDWVLCR IYKKINKAAA GDQQRSMECE DSVEDAVAAY HHPSYAMAAG  240
MGAGASTGAH GGSNYTSLLH HHHDSHEDNF LDGLLTAEDH AGLSAGATSL SHLAAASRAS  300
PAAAAAATKQ LLAPPSSSTP FNWLDSSPVG ILPQARNFPG FNRSRNNVVV GSMSLSSTAA  360
AMADGNGRGN NAVNTMPAFM NALPVVQDAS TYHQQHVILG TSMPLPPEST VSGAASAFQQ  420
HPVQISGVNW NP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-733620417165NO APICAL MERISTEM PROTEIN
1ut4_B2e-733620417165NO APICAL MERISTEM PROTEIN
1ut7_A2e-733620417165NO APICAL MERISTEM PROTEIN
1ut7_B2e-733620417165NO APICAL MERISTEM PROTEIN
3swm_A2e-733620420168NAC domain-containing protein 19
3swm_B2e-733620420168NAC domain-containing protein 19
3swm_C2e-733620420168NAC domain-containing protein 19
3swm_D2e-733620420168NAC domain-containing protein 19
3swp_A2e-733620420168NAC domain-containing protein 19
3swp_B2e-733620420168NAC domain-containing protein 19
3swp_C2e-733620420168NAC domain-containing protein 19
3swp_D2e-733620420168NAC domain-containing protein 19
4dul_A2e-733620417165NAC domain-containing protein 19
4dul_B2e-733620417165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00361DAPTransfer from AT3G15510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM8208900.0KM820890.1 Triticum aestivum cultivar Chinese Spring NAC transcription factor NAM-D2 (NAM-D2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003562891.10.0PREDICTED: NAC transcription factor NAM-B2-like
SwissprotA0SPJ90.0NAM2_HORVD; NAC transcription factor NAM-2
TrEMBLI1GTC30.0I1GTC3_BRADI; Uncharacterized protein
STRINGBRADI1G24390.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75723649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.18e-80NAC domain containing protein 25